Recombinant Human RPS19

Cat.No. : RPS19-29469TH
Product Overview : Recombinant fragment of Human RPS19 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Higher level expression is seen in the colon carcinoma tissue than normal colon tissue.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
Sequence Similarities : Belongs to the ribosomal protein S19e family.
Gene Name RPS19 ribosomal protein S19 [ Homo sapiens ]
Official Symbol RPS19
Synonyms RPS19; ribosomal protein S19; 40S ribosomal protein S19; DBA; Diamond Blackfan anemia; S19;
Gene ID 6223
mRNA Refseq NM_001022
Protein Refseq NP_001013
MIM 603474
Uniprot ID P39019
Chromosome Location 19q13.2
Pathway Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem;
Function RNA binding; protein binding; structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPS19 Products

Required fields are marked with *

My Review for All RPS19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon