Recombinant Human RORC Protein, GST-tagged

• Cat.No.: RORC-114H
• Product Overview: Recombinant Human RORC was expressed in insect cells with N-terminal GST tag.

Specification

• Source: Insect cells
• Species: Human
• Tag: GST
• Form: Liquid
• Molecular Mass: ~57 kDa as estimated in SDS-PAGE under reducing conditions.
• AA Sequence: YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
• Purity: > 90% determined by SDS-PAGE
• Storage: Immediately store at -80 centigrade. Avoid freeze-thaw cycles. While working, please keep sample on ice.
• Storage Buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 10 mM reduced glutathione, 20% glycerol.
• Publications:
  Discovery, Synthesis, and In Vitro Characterization of 2,3 Derivatives of 4,5,6,7-Tetrahydro-Benzothiophene as Potent Modulators of Retinoic Acid Receptor-Related Orphan Receptor γt (2023)
  Discovery, Synthesis, and In Vitro Characterization of 2,3 Derivatives of 4,5,6,7-Tetrahydro-Benzothiophene as Potent Modulators of Retinoic Acid Receptor-Related Orphan Receptor γt (2023)
  RORγt inverse agonist TF-S14 inhibits Th17 cytokines and prolongs skin allograft survival in sensitized mice (2024)

Gene Information

• Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
• Official Symbol: RORC
• Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
• Gene ID: 6097
• mRNA Refseq: NM_001001523
• Protein Refseq: NP_001001523
• MIM: 602943
• UniProt ID: P51449