Recombinant Human RORC Protein, GST-tagged

• Cat.No.: RORC-02H
• Product Overview: Recombinant Human RORC fused with GST tag was produced in Insect cells.

Specification

• Description: The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Insect cells
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl pH 8.0, 200 mM NaCl
• Molecular Mass: ~55kDa as estimated by SDS-PAGE under reducing condition.
• AA sequence: PYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWE
  MWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADN
  RTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQ
  EKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVV
  QAAFPPLYKELFS
• Purity: > 92% as determined by SDS-PAGE
• Storage: Please prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.25 mg/ml
• Publications:
  Discovery of 2‑(Ortho-Substituted Benzyl)-Indole Derivatives as Potent and Orally Bioavailable RORγ Agonists with Antitumor Activity (2021)

Gene Information

• Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
• Official Symbol: RORC
• Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
• Gene ID: 6097
• mRNA Refseq: NM_001001523
• Protein Refseq: NP_001001523
• MIM: 602943
• UniProt ID: P51449