Recombinant Human RORC Protein, His-SUMO-tagged

Cat.No. : RORC-1357H
Product Overview : Recombinant Human RORC Protein (1-518aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-518 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 74.2 kDa
AA Sequence : MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name RORC RAR-related orphan receptor C [ Homo sapiens ]
Official Symbol RORC
Synonyms RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
Gene ID 6097
mRNA Refseq NM_001001523
Protein Refseq NP_001001523
MIM 602943
UniProt ID P51449

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RORC Products

Required fields are marked with *

My Review for All RORC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon