Recombinant Human RORC Protein, His-SUMO-tagged
Cat.No. : | RORC-1357H |
Product Overview : | Recombinant Human RORC Protein (1-518aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-518 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 74.2 kDa |
AA Sequence : | MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
Official Symbol | RORC |
Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539 |
Gene ID | 6097 |
mRNA Refseq | NM_001001523 |
Protein Refseq | NP_001001523 |
MIM | 602943 |
UniProt ID | P51449 |
◆ Recombinant Proteins | ||
RORC-02H | Recombinant Human RORC Protein, GST-tagged | +Inquiry |
RORC-1357H | Recombinant Human RORC Protein, His-SUMO-tagged | +Inquiry |
RORC-6192H | Recombinant Human RORC Protein (Leu241-Phe486), N-His tagged | +Inquiry |
RORC-18H | Recombinant Human RORC protein, GST-tagged | +Inquiry |
RORC-6194H | Recombinant Human RORC Protein (Thr268-Phe494), N-His and N-SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *
0
Inquiry Basket