Recombinant Human RBBP6 protein, GST-tagged
Cat.No. : | RBBP6-23H |
Product Overview : | Recombinant Human RBBP6(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 118 a.a. |
Description : | The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ] |
Official Symbol | RBBP6 |
Synonyms | RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423; |
Gene ID | 5930 |
mRNA Refseq | NM_032626 |
Protein Refseq | NP_116015 |
MIM | 600938 |
UniProt ID | Q7Z6E9 |
Chromosome Location | 16p12.2 |
Function | ligase activity; metal ion binding; nucleic acid binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
RBBP6-1160Z | Recombinant Zebrafish RBBP6 | +Inquiry |
RBBP6-23H | Recombinant Human RBBP6 protein, GST-tagged | +Inquiry |
RBBP6-7794Z | Recombinant Zebrafish RBBP6 | +Inquiry |
RBBP6-2201H | Recombinant Human RBBP6 protein(Thr1151-Gly1260), His-tagged | +Inquiry |
RBBP6-2200H | Recombinant Human RBBP6, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP6-1480HCL | Recombinant Human RBBP6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBBP6 Products
Required fields are marked with *
My Review for All RBBP6 Products
Required fields are marked with *
0
Inquiry Basket