Recombinant Human RBBP6, GST-tagged
Cat.No. : | RBBP6-2200H |
Product Overview : | Recombinant Human RBBP6(1-118aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-118aa |
Tag : | N-GST |
Form : | Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Mannitol |
Molecular Mass : | The protein has a calculated MW of 39 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 80% as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.325mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD-LVPRGS-MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTA |
Gene Name | RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ] |
Official Symbol | RBBP6 |
Synonyms | RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423; |
Gene ID | 5930 |
mRNA Refseq | NM_006910 |
Protein Refseq | NP_008841 |
MIM | 600938 |
UniProt ID | Q7Z6E9 |
◆ Recombinant Proteins | ||
RBBP6-7794Z | Recombinant Zebrafish RBBP6 | +Inquiry |
RBBP6-1160Z | Recombinant Zebrafish RBBP6 | +Inquiry |
RBBP6-2201H | Recombinant Human RBBP6 protein(Thr1151-Gly1260), His-tagged | +Inquiry |
RBBP6-2200H | Recombinant Human RBBP6, GST-tagged | +Inquiry |
RBBP6-23H | Recombinant Human RBBP6 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP6-1480HCL | Recombinant Human RBBP6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBBP6 Products
Required fields are marked with *
My Review for All RBBP6 Products
Required fields are marked with *
0
Inquiry Basket