Recombinant Human RBBP6, GST-tagged

Cat.No. : RBBP6-2200H
Product Overview : Recombinant Human RBBP6(1-118aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability March 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-118aa
Tag : N-GST
Form : Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Mannitol
Molecular Mass : The protein has a calculated MW of 39 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 80% as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.325mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD-LVPRGS-MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTA
Gene Name RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ]
Official Symbol RBBP6
Synonyms RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423;
Gene ID 5930
mRNA Refseq NM_006910
Protein Refseq NP_008841
MIM 600938
UniProt ID Q7Z6E9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBBP6 Products

Required fields are marked with *

My Review for All RBBP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon