Recombinant Human PPA1 protein, His-tagged

• Cat.No.: PPA1-3442H
• Product Overview: Recombinant Human PPA1 protein(1-289 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-289 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ]
• Official Symbol: PPA1
• Synonyms: PPA1; pyrophosphatase (inorganic) 1; PP, pyrophosphatase (inorganic); inorganic pyrophosphatase; cytosolic inorganic pyrophosphatase; inorganic pyrophosphatase 1; IOPPP; PP1; Ppase; pyrophosphate phospho hydrolase; SID6 8061; PPase; pyrophosphatase 1; inorganic diphosphatase; diphosphate phosphohydrolase; pyrophosphate phospho-hydrolase; PP; SID6-8061; MGC111556
• Gene ID: 5464
• mRNA Refseq: NM_021129
• Protein Refseq: NP_066952
• MIM: 179030
• UniProt ID: Q15181