Recombinant Human PPA1 protein(1-289aa), GST-tagged

• Cat.No.: PPA1-1867H
• Product Overview: Recombinant Human PPA1 protein(Q15181)(1-289aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-289aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 59.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Gene Information

• Gene Name: PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ]
• Official Symbol: PPA1
• Synonyms: PPA1; pyrophosphatase (inorganic) 1; PP, pyrophosphatase (inorganic); inorganic pyrophosphatase; cytosolic inorganic pyrophosphatase; inorganic pyrophosphatase 1; IOPPP; PP1; Ppase; pyrophosphate phospho hydrolase; SID6 8061; PPase; pyrophosphatase 1; inorganic diphosphatase; diphosphate phosphohydrolase; pyrophosphate phospho-hydrolase; PP; SID6-8061; MGC111556
• Gene ID: 5464
• mRNA Refseq: NM_021129
• Protein Refseq: NP_066952
• MIM: 179030
• UniProt ID: Q15181