Recombinant Human PPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPA1-5998H
• Product Overview: PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.
• Molecular Mass: 32.7 kDa
• AA Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPA1 inorganic pyrophosphatase 1 [ Homo sapiens (human) ]
• Official Symbol: PPA1
• Synonyms: PPA1; pyrophosphatase (inorganic) 1; PP, pyrophosphatase (inorganic); inorganic pyrophosphatase; cytosolic inorganic pyrophosphatase; inorganic pyrophosphatase 1; IOPPP; PP1; Ppase; pyrophosphate phospho hydrolase; SID6 8061; PPase; pyrophosphatase 1; inorganic diphosphatase; diphosphate phosphohydrolase; pyrophosphate phospho-hydrolase; PP; SID6-8061; MGC111556
• Gene ID: 5464
• mRNA Refseq: NM_021129
• Protein Refseq: NP_066952
• MIM: 179030
• UniProt ID: Q15181