Recombinant Human POLR2J Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR2J-801H
• Product Overview: POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.
• Molecular Mass: 13.3 kDa
• AA Sequence: MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR2J RNA polymerase II subunit J [ Homo sapiens (human) ]
• Official Symbol: POLR2J
• Synonyms: POLR2J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; polymerase (RNA) II (DNA directed) polypeptide J (13.3kD); DNA-directed RNA polymerase II subunit RPB11-a; hRPB14; POLR2J1; RPB11; RPB11A; RPB11m; RNA polymerase II subunit B11-a; RNA polymerase II 13.3 kDa subunit; DNA-directed RNA polymerase II subunit J-1; MGC71910
• Gene ID: 5439
• mRNA Refseq: NM_006234
• Protein Refseq: NP_006225
• MIM: 604150
• UniProt ID: P52435