Recombinant Human PGAM1, GST-tagged

• Cat.No.: PGAM1-2487TH
• Product Overview: Recombinant Human PGAM1 (1 a.a. - 254 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway.
• Molecular Mass: 53.68 kDa
• Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: PGAM1

Gene Information

• Gene Name: PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ]
• Synonyms: PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; PGAM-B; phosphoglycerate mutase 1; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; Phosphoglycerate mutase A; nonmuscle form; EC 3.1.3.13; EC 5.4.2.1; EC 5.4.2.4
• Gene ID: 5223
• mRNA Refseq: NM_002629
• Protein Refseq: NP_002620
• MIM: 172250
• UniProt ID: P18669
• Chromosome Location: 10q25.3
• Pathway: Gluconeogenesis; Gluconeogenesis, oxaloacetate => fructose-6P; Glycine, serine and threonine metabolism
• Function: bisphosphoglycerate 2-phosphatase activity; bisphosphoglycerate mutase activity; hydrolase activity; isomerase activity; phosphoglycerate mutase activity