Recombinant Full Length Mumps Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL32555MF |
Product Overview : | Recombinant Full Length Mumps virus Hemagglutinin-neuraminidase(HN) Protein (P10866) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | MuV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MEPSKLFTISDNATFAPGPVNNAADKKTFRTCFRILVLSVQAVTLILVIVTLGELVRMIN DQGLSNQLSSITDKIRESATMIASAVGVMNQVIHGVTVSLPLQIEGNQNQLLSTLATICT SKKQISNCSTNIPLVNDLRFINGINKFIIEDYANHDFSIGHPLNMPSFIPTATSPNGCTR IPSFSLGKTHWCYTHNVINANCKDHTSSNQYVSMGILVQTASGYPMFKTLKIQYLSDGLN RKSCSIATVPDGCAMYCYVSTQLETDDYAGSSPPTQKLTLLFYNDTVTERTISPSGLEGN WATLVPGVGSGIYFENKLIFPAYGGVLPNSTLGVKLAREFFRPVNPYNPCSGPQQDLDQR ALRSYFPSYLSNRRVQSAFLVCAWNQILVTNCELVVPSNNQTLMGAEGRVLLINNRLLYY QRSTSWWPYELLYEISFTFTNSGQSSVNMSWIPIYSFTRPGSGKCSGENVCPIACVSGVY LDPWPLTPYSHQSGINRNFYFTGALLNSSTTRVNPTLYVSALNNLKVLAPYGTQGLSASY TTTTCFQDTGDASVYCVYIMELASNIVGEFQILPVLTRLTIT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P10866 |
◆ Recombinant Proteins | ||
RPAP1-4760R | Recombinant Rat RPAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14135NF | Recombinant Full Length Neisseria Gonorrhoeae Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged | +Inquiry |
G6PC-6129M | Recombinant Mouse G6PC Protein | +Inquiry |
SIX5-4210R | Recombinant Rhesus monkey SIX5 Protein, His-tagged | +Inquiry |
EMC10-011H | Recombinant Human EMC10 protein, HIS-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOSIP-3758HCL | Recombinant Human NOSIP 293 Cell Lysate | +Inquiry |
MTFP1-1152HCL | Recombinant Human MTFP1 cell lysate | +Inquiry |
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
TCOF1-1170HCL | Recombinant Human TCOF1 293 Cell Lysate | +Inquiry |
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket