Recombinant Full Length Human Parainfluenza 3 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL5931HF |
Product Overview : | Recombinant Full Length Human parainfluenza 3 virus Hemagglutinin-neuraminidase(HN) Protein (P12566) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV3 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MEYWKHTNHGKDAGNELETSMATHGNKLTNKITYILWTIILVLLSIVFIIVLINSIKSEK AHKSLLQDINNEFMEITEKIQMASDNTNDLIQSGVNTRLLTIQSHVQNYIPISLTQQMSD LRKFISEITIRNDNQEVPPQRIIHDVGIKPLNPDDFWRCTSGLPSLMRTPKIRLMPGPGL LAMPTTVDGCVRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLN PRISHTFNINDNRKSCSLALLNTDVYQLCSTPKVDERSDYASSGIEDIVLDIVNYDGSIS TTRFKNNNISFDQPYAASYPSVGPGIYYKGKIIFLGYGGLEHPINENVICNTTGCPGKTQ RDCNQASHSPWFSDRRMVNSIIVVDKGLNSIPKLKVWTISMRQNYWGSEGRLLLLGNKIY IYTRSTSWHSKLQLGIIDITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTD AYPLNPTGSIVSSVILDSQKSRVNPVITYSTATERVNELAIRNRTLSAGYTTTSCITHYN KGYCFHIVEINHKSSNTFQPMLFKTEIPKSCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12566 |
◆ Recombinant Proteins | ||
RPIA-31148TH | Recombinant Human RPIA, His-tagged | +Inquiry |
POR-387HF | Recombinant Full Length Human POR Protein | +Inquiry |
PNRC1-1886C | Recombinant Chicken PNRC1 | +Inquiry |
LPPR2-2299H | Recombinant Human LPPR2 Protein (1-156 aa), His-B2M-tagged | +Inquiry |
FLRT2-2342H | Recombinant Human FLRT2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
DNAJB9-6881HCL | Recombinant Human DNAJB9 293 Cell Lysate | +Inquiry |
NRN1-489HCL | Recombinant Human NRN1 cell lysate | +Inquiry |
LY96-771MCL | Recombinant Mouse LY96 cell lysate | +Inquiry |
FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket