Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL29267NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P12556) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVGRVALENEEREAKNTWRFVFRIAIFLLIVITLAISAAALVYSMEASTPGDLVGIP TVISRAEEKITSALSSNQDVVDRIYKQVALESPLALLNTESVIMNAITSLSYQINGAANN SGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDI SATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSV SATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYP GVGGGSFIDNRVWFPVYGGLKPNSPSDTAQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGPEGRVLTVGTSHFLYQRGSSY FSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDPYPLVFHR NHTLRGVFGTMLDDKQARLNPVSAVFDNISRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKEDGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12556 |
◆ Recombinant Proteins | ||
TRAT1-3398H | Recombinant Human TRAT1, His-tagged | +Inquiry |
PKIA-4480R | Recombinant Rat PKIA Protein | +Inquiry |
MRPS28-4865Z | Recombinant Zebrafish MRPS28 | +Inquiry |
ADAMTS15A-6733Z | Recombinant Zebrafish ADAMTS15A | +Inquiry |
RFL22606DF | Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor-Like Protein F(Crlf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
Tf-392R | Native Rat Transferrin | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTN1-996MCL | Recombinant Mouse CNTN1 cell lysate | +Inquiry |
PARP6-3427HCL | Recombinant Human PARP6 293 Cell Lysate | +Inquiry |
C16orf93-8244HCL | Recombinant Human C16orf93 293 Cell Lysate | +Inquiry |
CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
SPANXA1-1545HCL | Recombinant Human SPANXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket