Recombinant Full Length Human Parainfluenza 2 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL36545HF |
Product Overview : | Recombinant Full Length Human parainfluenza 2 virus Hemagglutinin-neuraminidase(HN) Protein (P25466) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MEDYSNLSLKSIPKRTCRIIFRTATILGICTLIVLCSSILHEIIHLDVSSGLMDSDDSQQ GIIQPIIESLKSLIALANQILYNVAIIIPLKIDSIETVIFSALKDMHTGSMSNTNCTPGN LLLHDAAYINGINKFLVLKSYNGTPKYGPLLNIPSFIPSATSPNGCTRIPSFSLIKTHWC YTHNVMLGDCLDFTTSNQYLAMGIIQQSAAAFPIFRTMKTIYLSDGINRKSCSVTAIPGG CVLYCYVATRSEKEDYATTDLAELRLAFYYYNDTFIERVISLPNTTGQWATINPAVGSGI YHLGFILFPVYGGLISGTPSYNKQSSRYFIPKHPNITCAGNSSEQAAAARSSYVIRYHSN RLIQSAVLICPLSDMHTARCNLVMFNNSQVMMGAEGRLYVIDNNLYYYQRSSSWWSASLF YRINTDFSKGIPPIIEAQWVPSYQVPRPGVMPCNATSFCPANCITGVYADVWPLNDPEPT SQNALNPNYRFAGAFLRNESNRTNPTFYTASASALLNTTGFNNTNHKAAYTSSTCFKNTG TQKIYCLIIIEMGSSLLGEFQIIPFLRELIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P25466 |
◆ Recombinant Proteins | ||
PRM2-2624H | Recombinant Human PRM2 Protein, His-tagged | +Inquiry |
SLMO2-943C | Recombinant Cynomolgus SLMO2 Protein, His-tagged | +Inquiry |
RPS27-5164R | Recombinant Rat RPS27 Protein | +Inquiry |
CCDC90B-0592H | Recombinant Human CCDC90B Protein, GST-Tagged | +Inquiry |
SLC15A5-15226M | Recombinant Mouse SLC15A5 Protein | +Inquiry |
◆ Native Proteins | ||
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
Thrombin-22H | Active Native Human Thrombin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNMB2-5026HCL | Recombinant Human KCNMB2 293 Cell Lysate | +Inquiry |
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
GAD1-586HCL | Recombinant Human GAD1 cell lysate | +Inquiry |
EFHC2-535HCL | Recombinant Human EFHC2 cell lysate | +Inquiry |
RCAN3-2448HCL | Recombinant Human RCAN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket