Recombinant Human NUDT16 protein, T7/His-tagged

• Cat.No.: NUDT16-237H
• Product Overview: Recombinant human NUDT16 (194aa, Isoform-II, derived from BC031215) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• ProteinLength: 194 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFAGARRLELGEALALGSGWRHVCHALLYAPDPGMLFGRIPLRYAILM QMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLA VEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: NUDT16 nudix (nucleoside diphosphate linked moiety X)-type motif 16 [ Homo sapiens ]
• Official Symbol: NUDT16
• Synonyms: NUDT16; nudix (nucleoside diphosphate linked moiety X)-type motif 16; U8 snoRNA-decapping enzyme; FLJ31265; nudix motif 16; U8 snoRNA-binding protein H29K; nucleoside diphosphate-linked moiety X motif 16; FLJ34034; FLJ36248
• Gene ID: 131870
• mRNA Refseq: NM_001171905
• Protein Refseq: NP_001165376
• UniProt ID: Q96DE0
• Chromosome Location: 3q21.3
• Function: RNA binding; hydrolase activity; metal ion binding