Recombinant Human METAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : METAP1-3777H
Product Overview : METAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055958) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Diseases associated with METAP1 include Microsporidiosis. Among its related pathways are Signaling by GPCR and Metabolism of fat-soluble vitamins. Gene Ontology (GO) annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D.
Molecular Mass : 30.37 kDa
AA Sequence : MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name METAP1 methionyl aminopeptidase 1 [ Homo sapiens (human) ]
Official Symbol METAP1
Synonyms METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419;
Gene ID 23173
mRNA Refseq NM_015143
Protein Refseq NP_055958
MIM 610151
UniProt ID P53582

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METAP1 Products

Required fields are marked with *

My Review for All METAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon