Recombinant Human METAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METAP1-3777H
• Product Overview: METAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055958) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Diseases associated with METAP1 include Microsporidiosis. Among its related pathways are Signaling by GPCR and Metabolism of fat-soluble vitamins. Gene Ontology (GO) annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D.
• Molecular Mass: 30.37 kDa
• AA Sequence: MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METAP1 methionyl aminopeptidase 1 [ Homo sapiens (human) ]
• Official Symbol: METAP1
• Synonyms: METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419
• Gene ID: 23173
• mRNA Refseq: NM_015143
• Protein Refseq: NP_055958
• MIM: 610151
• UniProt ID: P53582