Recombinant Human METAP1 Protein, GST-tagged

• Cat.No.: METAP1-4416H
• Product Overview: Human METAP1 full-length ORF ( NP_055958.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Signaling by GPCR. GO annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D.
• Molecular Mass: 56.8 kDa
• AA Sequence: MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METAP1 methionyl aminopeptidase 1 [ Homo sapiens ]
• Official Symbol: METAP1
• Synonyms: METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419
• Gene ID: 23173
• mRNA Refseq: NM_015143
• Protein Refseq: NP_055958
• MIM: 610151
• UniProt ID: P53582