Recombinant Human NT5C3A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NT5C3A-5423H
• Product Overview: NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4.
• Molecular Mass: 33.9 kDa
• AA Sequence: MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NT5C3A 5'-nucleotidase, cytosolic IIIA [ Homo sapiens (human) ]
• Official Symbol: NT5C3A
• Synonyms: NT5C3A; 5'-nucleotidase, cytosolic IIIA; p36; PN-I; POMP; PSN1; UMPH; NT5C3; P5N-1; UMPH1; hUMP1; P5'N-1; cN-III; cytosolic 5'-nucleotidase 3A; 5'-nucleotidase, cytosolic III; 7-methylguanosine phosphate-specific 5'-nucleotidase; cytosolic 5'-nucleotidase 3; lupin; pyrimidine 5'-nucleotidase 1; uridine 5'-monophosphate hydrolase 1; EC 3.1.3.5; EC 3.1.3.91
• Gene ID: 51251
• mRNA Refseq: NM_016489
• Protein Refseq: NP_057573
• MIM: 606224
• UniProt ID: Q9H0P0