Recombinant Human NPPB Protein, His-tagged

• Cat.No.: NPPB-1409H
• Product Overview: Recombinant Human Natriuretic Peptides B was expressed in E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 27-134 a.a.
• Form: Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860