Recombinant Human NPPB Protein, His-tagged
Cat.No. : | NPPB-1409H |
Product Overview : | Recombinant Human Natriuretic Peptides B was expressed in E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-134 a.a. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | NPPB natriuretic peptide B [ Homo sapiens ] |
Official Symbol | NPPB |
Synonyms | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID | 4879 |
mRNA Refseq | NM_002521 |
Protein Refseq | NP_002512 |
MIM | 600295 |
UniProt ID | P16860 |
◆ Recombinant Proteins | ||
NPPB-8050H | Synthetic Human Brain Natriuretic Peptide 32 | +Inquiry |
NPPB-1298H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
Nppb-2768M | Recombinant Mouse Nppb protein, His & GST-tagged | +Inquiry |
NPPB-1857H | Synthesized Human B-type Natriuretic Peptide | +Inquiry |
NPPB-4733H | Recombinant Human NPPB Protein (His27-Arg102), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
0
Inquiry Basket