Synthesized Human B-type Natriuretic Peptide
Cat.No. : | NPPB-1857H |
Product Overview : | B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives. |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Purity : | Greater than 95.0% as determined by RP-HPLC. |
Storage : | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Gene Name | NPPB natriuretic peptide B [ Homo sapiens ] |
Official Symbol | NPPB |
Synonyms | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID | 4879 |
mRNA Refseq | NM_002521 |
Protein Refseq | NP_002512 |
MIM | 600295 |
UniProt ID | P16860 |
Chromosome Location | 1p36.2 |
Pathway | MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
Function | diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
NPPB-2766D | Recombinant Dog NPPB protein, His & GST-tagged | +Inquiry |
Nppb-1851R | Recombinant Rat Nppb Protein, His-tagged | +Inquiry |
Nppb-2768M | Recombinant Mouse Nppb protein, His & GST-tagged | +Inquiry |
NPPB-13H | Recombinant Human BNP-32 Protein, N-6×His and C-mIgG Fc tagged | +Inquiry |
NPPB-6643HF | Recombinant Full Length Human NPPB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *