Synthetic Human Brain Natriuretic Peptide 32
Cat.No. : | NPPB-8050H |
Product Overview : | Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis. Molecular Formula: C143H244N50O42S4 Disulfide bridge: Cys10-Cys26 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Molecular Mass : | 3464.1 |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Purity : | > 95% |
Storage : | Store the peptide at -20 centigrade. |
Gene Name | NPPB natriuretic peptide B [ Homo sapiens (human) ] |
Official Symbol | NPPB |
Synonyms | NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein |
Gene ID | 4879 |
mRNA Refseq | NM_002521 |
Protein Refseq | NP_002512 |
MIM | 600295 |
UniProt ID | P16860 |
◆ Recombinant Proteins | ||
NPPB-31085TH | Recombinant Human NPPB protein | +Inquiry |
NPPB-6042H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
NPPB-4733H | Recombinant Human NPPB Protein (His27-Arg102), N-His tagged | +Inquiry |
Nppb-2767M | Recombinant Mouse Nppb protein, His-tagged | +Inquiry |
NPPB-4732H | Recombinant Human NPPB Protein (His27-Arg102), N-His Flag tagged | +Inquiry |
◆ Native Proteins | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
0
Inquiry Basket