Recombinant Human NAT1
Cat.No. : | NAT1-28863TH |
Product Overview : | Recombinant full length Human NAT1 (amino acids 1-290) with N terminal proprietary tag, 57.97 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 290 amino acids |
Description : | This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 57.970kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENL NIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALT TIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWY LDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIE DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV PKHGDRFFTI |
Sequence Similarities : | Belongs to the arylamine N-acetyltransferase family. |
Gene Name | NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ] |
Official Symbol | NAT1 |
Synonyms | NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1; |
Gene ID | 9 |
mRNA Refseq | NM_000662 |
Protein Refseq | NP_000653 |
MIM | 108345 |
Uniprot ID | P18440 |
Chromosome Location | 8p22 |
Pathway | Acetylation, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem; |
Function | acetyltransferase activity; arylamine N-acetyltransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
TAS2R107-8997M | Recombinant Mouse TAS2R107 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIF27-2911R | Recombinant Rat KIF27 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il17a-334M | Recombinant Mouse Il17a, His-tagged | +Inquiry |
HPX-2563R | Recombinant Rat HPX Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOT-556H | Recombinant Human MYOT protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFAND6-184HCL | Recombinant Human ZFAND6 293 Cell Lysate | +Inquiry |
PDSS2-3319HCL | Recombinant Human PDSS2 293 Cell Lysate | +Inquiry |
CERS2-4819HCL | Recombinant Human LASS2 293 Cell Lysate | +Inquiry |
MZF1-1164HCL | Recombinant Human MZF1 cell lysate | +Inquiry |
PPP6R3-2066HCL | Recombinant Human SAPS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NAT1 Products
Required fields are marked with *
My Review for All NAT1 Products
Required fields are marked with *
0
Inquiry Basket