Recombinant Human NAT1, His-tagged

• Cat.No.: NAT1-30282TH
• Product Overview: Recombinant full length protein, (amino acids 1-290) of Human NAT1 with N terminal His tag; 310 amino acids, 36.1 kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 290 amino acids
• Description: This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 36.100kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCIFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
• Sequence Similarities: Belongs to the arylamine N-acetyltransferase family.

Gene Information

• Gene Name: NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ]
• Official Symbol: NAT1
• Synonyms: NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1
• Gene ID: 9
• mRNA Refseq: NM_000662
• Protein Refseq: NP_000653
• MIM: 108345
• Uniprot ID: P18440
• Chromosome Location: 8p22
• Pathway: Acetylation, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem
• Function: acetyltransferase activity; arylamine N-acetyltransferase activity; transferase activity, transferring acyl groups