Recombinant Human MYCN protein, GST-tagged
Cat.No. : | MYCN-27993TH |
Product Overview : | Recombinant Human MYCN(1 a.a. - 464 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-464 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 76 kDa |
AA Sequence : | MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPP SWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGI AAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNS DSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCN |
Synonyms | MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc; |
Gene ID | 4613 |
mRNA Refseq | NM_005378 |
Protein Refseq | NP_005369 |
MIM | 164840 |
UniProt ID | P04198 |
Chromosome Location | 2p24.3 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MYCN-7006HF | Recombinant Full Length Human MYCN Protein, GST-tagged | +Inquiry |
MYCN-2244H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
MYCN-35H | Recombinant Human MYCN Protein (Full length), N-GST-tagged | +Inquiry |
MYCN-30409TH | Recombinant Human MYCN | +Inquiry |
MYCN-5832M | Recombinant Mouse MYCN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCN-4036HCL | Recombinant Human MYCN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYCN Products
Required fields are marked with *
My Review for All MYCN Products
Required fields are marked with *
0
Inquiry Basket