Recombinant Human MYCN protein, GST-tagged
Cat.No. : | MYCN-27993TH |
Product Overview : | Recombinant Human MYCN(1 a.a. - 464 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
ProteinLength : | 1-464 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 76 kDa |
AA Sequence : | MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPP SWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGI AAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNS DSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCN |
Synonyms | MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc; |
Gene ID | 4613 |
mRNA Refseq | NM_005378 |
Protein Refseq | NP_005369 |
MIM | 164840 |
UniProt ID | P04198 |
Chromosome Location | 2p24.3 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
RFL7871SF | Recombinant Full Length Shewanella Putrefaciens Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
EMILIN3-1465R | Recombinant Rhesus monkey EMILIN3 Protein, His-tagged | +Inquiry |
GNGT2-1728R | Recombinant Rhesus Macaque GNGT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCP2A-11114Z | Recombinant Zebrafish SCP2A | +Inquiry |
ELOVL6-1278R | Recombinant Rhesus Macaque ELOVL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
TF-391H | Native Human Transferrin | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3L3-7287HCL | Recombinant Human CREB3L3 293 Cell Lysate | +Inquiry |
LRRTM1-4617HCL | Recombinant Human LRRTM1 293 Cell Lysate | +Inquiry |
Heart Atrium-201H | Human Heart Atrium (LT) (Diseased) Lysate | +Inquiry |
Uterus-748R | Rabbit Uterus Lysate, Total Protein | +Inquiry |
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MYCN Products
Required fields are marked with *
My Review for All MYCN Products
Required fields are marked with *
0
Inquiry Basket