Recombinant Full Length Human MYCN Protein, GST-tagged

Cat.No. : MYCN-7006HF
Product Overview : Recombinant Human full-length MYCN(1 a.a. - 464 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 464 amino acids
Description : This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 76 kDa
AA Sequence : MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPP SWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGI AAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNS DSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ]
Official Symbol MYCN
Synonyms MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc;
Gene ID 4613
mRNA Refseq NM_005378
Protein Refseq NP_005369
MIM 164840
UniProt ID P04198

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYCN Products

Required fields are marked with *

My Review for All MYCN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon