Recombinant Full Length Human MYCN Protein, GST-tagged

• Cat.No.: MYCN-7006HF
• Product Overview: Recombinant Human full-length MYCN(1 a.a. - 464 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 464 amino acids
• Description: This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 76 kDa
• AA Sequence: MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPP SWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGI AAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNS DSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ]
• Official Symbol: MYCN
• Synonyms: MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc
• Gene ID: 4613
• mRNA Refseq: NM_005378
• Protein Refseq: NP_005369
• MIM: 164840
• UniProt ID: P04198