Recombinant Human MYCN

• Cat.No.: MYCN-30409TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-100 of Human n-Myc with a proprietary tag; Predicted MWt 36.63 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ]
• Official Symbol: MYCN
• Synonyms: MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc
• Gene ID: 4613
• mRNA Refseq: NM_005378
• Protein Refseq: NP_005369
• MIM: 164840
• Uniprot ID: P04198
• Chromosome Location: 2p24.3
• Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding transcription factor activity