Recombinant Human MVP, GST-tagged
Cat.No. : | MVP-1115H |
Product Overview : | Recombinant Human MVP(1 a.a. - 893 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene. |
Molecular Mass : | 123.97 kDa |
AA Sequence : | MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLF DVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEGPGT YIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKT ALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR VVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLEYVPSAKVEVVE ERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLA PRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTD VITIETADHARLQLQLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR TAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKH EAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQA LAIETEAELQRVQKVRELELVYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSL GLKSTLITDGSTPINLFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MVP major vault protein [ Homo sapiens (human) ] |
Official Symbol | MVP |
Synonyms | MVP; major vault protein; LRP; lung resistance related protein; VAULT1; lung resistance-related protein |
Gene ID | 9961 |
mRNA Refseq | NM_005115 |
Protein Refseq | NP_005106 |
MIM | 605088 |
UniProt ID | Q14764 |
Chromosome Location | 16p11.2 |
Function | protein binding; protein kinase binding; protein phosphatase binding |
◆ Recombinant Proteins | ||
ATP5S-881R | Recombinant Rat ATP5S Protein | +Inquiry |
RIPK2-6795HF | Recombinant Full Length Human RIPK2 Protein, GST-tagged | +Inquiry |
C9orf40-2047H | Recombinant Human C9orf40 Protein, MYC/DDK-tagged | +Inquiry |
SAP049A-031-4578S | Recombinant Staphylococcus aureus (strain: NE 3868) SAP049A_031 protein, His-tagged | +Inquiry |
RFL1657MF | Recombinant Full Length Murine Coronavirus Non-Structural Protein 4(4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS2-4146HCL | Recombinant Human MRPS2 293 Cell Lysate | +Inquiry |
OAS2-3614HCL | Recombinant Human OAS2 293 Cell Lysate | +Inquiry |
POLR3D-3025HCL | Recombinant Human POLR3D 293 Cell Lysate | +Inquiry |
DR1-6820HCL | Recombinant Human DR1 293 Cell Lysate | +Inquiry |
HA-2670HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MVP Products
Required fields are marked with *
My Review for All MVP Products
Required fields are marked with *
0
Inquiry Basket