Recombinant Full Length Human MVP Protein, GST-tagged
Cat.No. : | MVP-6998HF |
Product Overview : | Recombinant Human full-length MVP(1 a.a. - 893 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 893 amino acids |
Description : | This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene. |
Molecular Mass : | 123.97 kDa |
AA Sequence : | MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLF DVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEGPGT YIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKT ALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR VVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLEYVPSAKVEVVE ERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLA PRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTD VITIETADHARLQLQLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR TAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKH EAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQA LAIETEAELQRVQKVRELELVYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSL GLKSTLITDGSTPINLFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MVP major vault protein [ Homo sapiens (human) ] |
Official Symbol | MVP |
Synonyms | MVP; major vault protein; LRP; lung resistance related protein; VAULT1; lung resistance-related protein |
Gene ID | 9961 |
mRNA Refseq | NM_005115 |
Protein Refseq | NP_005106 |
MIM | 605088 |
UniProt ID | Q14764 |
◆ Native Proteins | ||
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USE1-481HCL | Recombinant Human USE1 293 Cell Lysate | +Inquiry |
TMEM183A-679HCL | Recombinant Human TMEM183A lysate | +Inquiry |
BCCIP-001HCL | Recombinant Human BCCIP cell lysate | +Inquiry |
NPBWR1-3745HCL | Recombinant Human NPBWR1 293 Cell Lysate | +Inquiry |
ASS1-8639HCL | Recombinant Human ASS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MVP Products
Required fields are marked with *
My Review for All MVP Products
Required fields are marked with *
0
Inquiry Basket