Recombinant Human MPO protein, His-tagged

• Cat.No.: MPO-493H
• Product Overview: Recombinant Human MPO(165-278aa) fused with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 165-278aa
• Description: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils.
• Molecular Mass: 17.4kD
• AA Sequence: VTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTG

Gene Information

• Gene Name: MPO myeloperoxidase [ Homo sapiens ]
• Official Symbol: MPO
• Synonyms: MPO; myeloperoxidase
• Gene ID: 4353
• mRNA Refseq: NM_000250
• Protein Refseq: NP_000241
• MIM: 606989
• UniProt ID: P05164
• Chromosome Location: 17q21.3-q23
• Pathway: C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem
• Function: chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity