Recombinant Human MPO protein, His-tagged

Cat.No. : MPO-493H
Product Overview : Recombinant Human MPO(165-278aa) fused with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 165-278aa
Description : Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils.
Molecular Mass : 17.4kD
AA Sequence : VTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTG
Gene Name MPO myeloperoxidase [ Homo sapiens ]
Official Symbol MPO
Synonyms MPO; myeloperoxidase;
Gene ID 4353
mRNA Refseq NM_000250
Protein Refseq NP_000241
MIM 606989
UniProt ID P05164
Chromosome Location 17q21.3-q23
Pathway C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem;
Function chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MPO Products

Required fields are marked with *

My Review for All MPO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon