Recombinant Human MICA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MICA-6630H |
Product Overview : | MICA MS Standard C13 and N15-labeled recombinant protein (NP_000238) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MICA MHC class I polypeptide-related sequence A [ Homo sapiens (human) ] |
Official Symbol | MICA |
Synonyms | MICA; MHC class I polypeptide-related sequence A; PERB11.1; HLA class I antigen; stress inducible class I homolog; MHC class I chain-related protein A; MIC-A; FLJ36918; FLJ60820; MGC21250; MGC111087; |
Gene ID | 100507436 |
mRNA Refseq | NM_000247 |
Protein Refseq | NP_000238 |
MIM | 600169 |
UniProt ID | Q29983 |
◆ Recombinant Proteins | ||
MICA-1280H | Recombinant Human MICA protein | +Inquiry |
MICA-07H | Recombinant Human MHC class I polypeptide-related sequence A | +Inquiry |
MICA-5319H | Recombinant Human MICA Protein, GST-tagged | +Inquiry |
MICA-0494H | Active Recombinant Human MICA protein, Fc-tagged | +Inquiry |
MICA-823H | Recombinant Human MICA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MICA-1941HCL | Recombinant Human MICA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MICA Products
Required fields are marked with *
My Review for All MICA Products
Required fields are marked with *
0
Inquiry Basket