Recombinant Human MICA protein

• Cat.No.: MICA-1280H
• Product Overview: Recombinant Human MICA protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 320
• Description: MIC-A (MHC class I chain-related gene A) is a single-pass type I member protein. It is expressed on the cell surface in gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm in keratinocytes and monocytes. Additionally, MIC-A can be induced by bacterial and viral infections. It shares 85 % amino acid identity with MIC-B and they are distantly related to the MHC class I proteins. Because they possess three extracellular Ig-like domains, but unlike classical MHC class I molecules. They do not form a heterodimer with beta2 microglobulin, but bind as a monomer to a KLRK1/NKG2D that is an activating receptor expressed on NK cells, NKT cells, γδ T cells, and CD8+ αβ T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MIC-A recognition plays an important role in tumor surveillance, viral infections, and autoimmune diseases.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, and 8 M Urea.
• Bio-activity: Fully biologically active when compared to standard. The specific activity is determined by binding MICA antibody in ELISA.
• Molecular Mass: Approximately 36.9 kDa, a single non-glycosylated polypeptide chain containing 320 amino acids.
• AA Sequence: MSYYHHHHHHDYDIPTTENLYFQGAMDPEFEPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHKLGCFGG
• Endotoxin: Less than 1 EU/µg of rHuMIC-A, His as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions, which contain 8 M Urea.

Gene Information

• Gene Name: MICA
• Official Symbol: MICA
• Synonyms: MICA; MHC class I polypeptide-related sequence A; PERB11.1; HLA class I antigen; stress inducible class I homolog; MHC class I chain-related protein A; MIC-A; FLJ36918; FLJ60820; MGC21250; MGC111087
• Gene ID: 100507436
• mRNA Refseq: NM_000247
• Protein Refseq: NP_000238
• MIM: 600169
• UniProt ID: Q29983