Recombinant Human MICA Protein, GST-tagged

• Cat.No.: MICA-5319H
• Product Overview: Human MICA full-length ORF ( NP_000238.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. [provided by RefSeq
• Molecular Mass: 69.3 kDa
• AA Sequence: MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MICA MHC class I polypeptide-related sequence A [ Homo sapiens ]
• Official Symbol: MICA
• Synonyms: MICA; MHC class I polypeptide-related sequence A; PERB11.1; HLA class I antigen; stress inducible class I homolog; MHC class I chain-related protein A; MIC-A; FLJ36918; FLJ60820; MGC21250; MGC111087
• Gene ID: 100507436
• mRNA Refseq: NM_000247
• Protein Refseq: NP_000238
• MIM: 600169
• UniProt ID: Q29983