Active Recombinant Human MICA Protein, His-tagged
Cat.No. : | MICA-03H |
Product Overview : | Recombinant human MICA, fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human NKG2D. |
Molecular Mass : | 32.7 kDa (283aa) confirmed by MALDI-TOF |
AA Sequence : | MEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% Glycerol |
Gene Name | MICA MHC class I polypeptide-related sequence A [ Homo sapiens (human) ] |
Official Symbol | MICA |
Synonyms | MICA; MHC class I polypeptide-related sequence A; MIC-A; PERB11.1; MHC class I polypeptide-related sequence A; HLA class I antigen; MHC class I chain-related protein A; MHC class I related chain A; MHC class I related sequence A; major histocompatibility complex class I chain-related protein A; stress inducible class I homolog |
Gene ID | 100507436 |
mRNA Refseq | NM_000247 |
Protein Refseq | NP_000238 |
MIM | 600169 |
UniProt ID | Q29983 |
◆ Recombinant Proteins | ||
MICA-03H | Active Recombinant Human MICA Protein, His-tagged | +Inquiry |
MICA-30099TH | Recombinant Human MICA | +Inquiry |
MICA-3861H | Recombinant Human MICA Protein (Glu24-Gln308), C-His tagged | +Inquiry |
MICA-3970H | Recombinant Human MICA protein, His-tagged | +Inquiry |
MICA-0492H | Recombinant Human MICA protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MICA-1941HCL | Recombinant Human MICA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MICA Products
Required fields are marked with *
My Review for All MICA Products
Required fields are marked with *
0
Inquiry Basket