Recombinant Human METTL1 Protein, GST-tagged

• Cat.No.: METTL1-4411H
• Product Overview: Human METTL1 full-length ORF ( NP_005362.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq
• Molecular Mass: 57.9 kDa
• AA Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL1 methyltransferase like 1 [ Homo sapiens ]
• Official Symbol: METTL1
• Synonyms: METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8; D1075-like gene product; methyltransferase-like 1; tRNA(m7G46)-methyltransferase; methyltransferase-like protein 1; tRNA (guanine(46)-N(7))-methyltransferase; C12orf1; YDL201w; FLJ95748
• Gene ID: 4234
• mRNA Refseq: NM_005371
• Protein Refseq: NP_005362
• MIM: 604466
• UniProt ID: Q9UBP6