Recombinant Human METTL1, His-tagged

• Cat.No.: METTL1-29205TH
• Product Overview: Recombinant full length Human METTL1 with N terminal His tag; 296 amino acids with tag; Predicted MWt 33.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 276 amino acids
• Description: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
• Conjugation: HIS
• Molecular Weight: 33.600kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

Gene Information

• Gene Name: METTL1 methyltransferase like 1 [ Homo sapiens ]
• Official Symbol: METTL1
• Synonyms: METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8
• Gene ID: 4234
• mRNA Refseq: NM_005371
• Protein Refseq: NP_005362
• MIM: 604466
• Uniprot ID: Q9UBP6
• Chromosome Location: 12q13
• Function: methyltransferase activity; protein binding; tRNA (guanine-N7-)-methyltransferase activity; contributes_to tRNA (guanine-N7-)-methyltransferase activity; tRNA binding