Recombinant Human MESD Protein, GST-tagged

• Cat.No.: MESD-4434H
• Product Overview: Human MESDC2 full-length ORF ( NP_055969.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MESD (Mesoderm Development LRP Chaperone) is a Protein Coding gene. Diseases associated with MESD include Autosomal Dominant Nocturnal Frontal Lobe Epilepsy 2. Among its related pathways are Wnt / Hedgehog / Notch.
• Molecular Mass: 52.5 kDa
• AA Sequence: MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MESD mesoderm development LRP chaperone [ Homo sapiens (human) ]
• Official Symbol: MESD
• Synonyms: MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61
• Gene ID: 23184
• mRNA Refseq: NM_015154
• Protein Refseq: NP_055969
• MIM: 607783
• UniProt ID: Q14696