Recombinant Human HBA1 Protein, GST-tagged

• Cat.No.: HBA1-4594H
• Product Overview: Human HBA1 partial ORF ( NP_000549, 33 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5 untranslated regions and the introns, but they differ significantly over the 3 untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBA1 hemoglobin, alpha 1 [ Homo sapiens ]
• Official Symbol: HBA1
• Synonyms: HBA1; hemoglobin, alpha 1; hemoglobin subunit alpha; alpha-globin; alpha-1 globin; alpha-1-globin; alpha one globin; hemoglobin alpha chain; hemoglobin alpha-1 chain; hemoglobin alpha 1 globin chain; HBH; CD31; MGC126895; MGC126897
• Gene ID: 3039
• mRNA Refseq: NM_000558
• Protein Refseq: NP_000549
• UniProt ID: P69905