Recombinant Full Length Geobacillus Thermodenitrificans Thiol-Disulfide Oxidoreductase Resa(Resa) Protein, His-Tagged
Cat.No. : | RFL24211GF |
Product Overview : | Recombinant Full Length Geobacillus thermodenitrificans Thiol-disulfide oxidoreductase resA(resA) Protein (A4IQF5) (1-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus thermodenitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-174) |
Form : | Lyophilized powder |
AA Sequence : | MKKQQRLVMRTVILLLLLAALGYTIYANFFTEKTAVAVGSTAPDFVLSDLEGREHRLTDY RGKGVFLNFWGTWCKPCEREMPYMNELYPIYQKQGVEILAVNVGEPKLNVEKFAERFGLT FPIVIDRQDQVLNAYGVGPLPTTFLIDKNGKVKKIITGTMTKEDIKQHLESIKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | resA |
Synonyms | resA; GTNG_2210; Thiol-disulfide oxidoreductase ResA |
UniProt ID | A4IQF5 |
◆ Recombinant Proteins | ||
RFL152HF | Recombinant Full Length Human Mitochondrial Fission Process Protein 1(Mtfp1) Protein, His-Tagged | +Inquiry |
THSD7A-127HL | Recombinant Human THSD7A HEK293T cell lysate | +Inquiry |
PLAGL1-752H | Recombinant Human PLAGL1 Protein, His-tagged | +Inquiry |
HK3-7714M | Recombinant Mouse HK3 Protein | +Inquiry |
PHF14-2075C | Recombinant Chicken PHF14 | +Inquiry |
◆ Native Proteins | ||
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
FABP-175C | Native Guinea Pig Fatty acid Binding Protein | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
SPANXB1-1544HCL | Recombinant Human SPANXB1 293 Cell Lysate | +Inquiry |
HBB-5622HCL | Recombinant Human HBB 293 Cell Lysate | +Inquiry |
CPBT-32010GR | Goat Anti-Rat SERPINA6 Polyclonal Antibody | +Inquiry |
RPLP2-1541HCL | Recombinant Human RPLP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All resA Products
Required fields are marked with *
My Review for All resA Products
Required fields are marked with *
0
Inquiry Basket