Recombinant Human ABCE1 protein, His-tagged
Cat.No. : | ABCE1-5743H |
Product Overview : | Recombinant Human ABCE1 protein(250-599 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 250-599 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | KQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD |
Gene Name | ABCE1 ATP-binding cassette, sub-family E (OABP), member 1 [ Homo sapiens ] |
Official Symbol | ABCE1 |
Synonyms | RLI; OABP; ABC38; RNS4I; RNASEL1; RNASELI |
Gene ID | 6059 |
mRNA Refseq | NM_002940.2 |
Protein Refseq | NP_002931.2 |
MIM | 601213 |
UniProt ID | P61221 |
◆ Recombinant Proteins | ||
AFF4-989HF | Recombinant Full Length Human AFF4 Protein, GST-tagged | +Inquiry |
AFF4-2439H | Recombinant Human AFF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCE1-5743H | Recombinant Human ABCE1 protein, His-tagged | +Inquiry |
AFF4-696H | Recombinant Human AFF4 | +Inquiry |
AFF4-407H | Recombinant Human AFF4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFF4-8988HCL | Recombinant Human AFF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFF4 Products
Required fields are marked with *
My Review for All AFF4 Products
Required fields are marked with *
0
Inquiry Basket