Recombinant Human MED22 Protein, GST-tagged

• Cat.No.: MED22-4473H
• Product Overview: Human MED22 full-length ORF ( NP_852468.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
• Molecular Mass: 42.9 kDa
• AA Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED22 mediator complex subunit 22 [ Homo sapiens ]
• Official Symbol: MED22
• Synonyms: MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682
• Gene ID: 6837
• mRNA Refseq: NM_133640
• Protein Refseq: NP_598395
• MIM: 185641
• UniProt ID: Q15528