Recombinant Human MED22 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MED22-1043H
• Product Overview: MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed.
• Molecular Mass: 16.5 kDa
• AA Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MED22 mediator complex subunit 22 [ Homo sapiens (human) ]
• Official Symbol: MED22
• Synonyms: MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682
• Gene ID: 6837
• mRNA Refseq: NM_181491
• Protein Refseq: NP_852468
• MIM: 185641
• UniProt ID: Q15528