Recombinant Human MED22 protein, His-tagged
Cat.No. : | MED22-3382H |
Product Overview : | Recombinant Human MED22 protein(1-140 aa), fused to His tag, was expressed in E. coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-140 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens ] |
Official Symbol | MED22 |
Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
Gene ID | 6837 |
mRNA Refseq | NM_133640 |
Protein Refseq | NP_598395 |
MIM | 185641 |
UniProt ID | Q15528 |
◆ Recombinant Proteins | ||
MED22-3382H | Recombinant Human MED22 protein, His-tagged | +Inquiry |
MED22-9694M | Recombinant Mouse MED22 Protein | +Inquiry |
MED22-1043H | Recombinant Human MED22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MED22-2721R | Recombinant Rhesus monkey MED22 Protein, His-tagged | +Inquiry |
MED22-369Z | Recombinant Zebrafish MED22 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *
0
Inquiry Basket