Recombinant Human ITGAE Protein, GST-tagged

• Cat.No.: ITGAE-4990H
• Product Overview: Human ITGAE partial ORF ( NP_002199, 57 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.39 kDa
• AA Sequence: SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ]
• Official Symbol: ITGAE
• Synonyms: ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE; HML-1 antigen; integrin alpha-IEL; mucosal lymphocyte 1 antigen; antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide; MGC141996
• Gene ID: 3682
• mRNA Refseq: NM_002208
• Protein Refseq: NP_002199
• MIM: 604682
• UniProt ID: P38570