Recombinant Human ITGAE

• Cat.No.: ITGAE-29495TH
• Product Overview: Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa.

Specification

• Description: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
• Protein length: 115 amino acids
• Molecular Weight: 38.280kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
• Sequence Similarities: Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain.
• Tag: Non

Gene Information

• Gene Name: ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ]
• Official Symbol: ITGAE
• Synonyms: ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE
• Gene ID: 3682
• mRNA Refseq: NM_002208
• Protein Refseq: NP_002199
• MIM: 604682
• Uniprot ID: P38570
• Chromosome Location: 17p13
• Pathway: E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem
• Function: receptor activity