Recombinant Human INS therapeutic protein(Insulin glargine)

• Cat.No.: Insulin-P057H
• Product Overview: Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration.

Specification

• Description: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Molecular Mass: 60.6 Kda
• Protein length: 32aa
• AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Tag: Non
• Alias: INS; ILPR; IRDN; IDDM2; Insulin glargine

Gene Information

• Gene Name: INS insulin [ Homo sapiens ]
• Official Symbol: INS
• Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10
• Gene ID: 3630
• mRNA Refseq: NM_000207
• Protein Refseq: NP_000198
• UniProt ID: P01308
• Chromosome Location: 11p15.5
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding