Recombinant Human IFNG therapeutic protein (Interferon gamma-1b)

Description :	This gene encodes a member of the type II interferon family. The protein encoded is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. The expression product is the active ingredient of Actimmune.
Source :	E. coli
Species :	Human
Molecular Mass :	17.1 Kda
Protein length :	146aa
AA Sequence :	CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQK SVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR RASQ
Endotoxin :	< 1.0 EU per μg of the protein
Purity :	>95%
Storage :	Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Tag :	Non
Alias :	IFNG; IFN-gamma; IFG; IFI; Interferon gamma-1b

Gene Name	IFNG interferon, gamma [ Homo sapiens ]
Official Symbol	IFNG
Synonyms	IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID	3458
mRNA Refseq	NM_000619
Protein Refseq	NP_000610
MIM	147570
UniProt ID	P01579
Chromosome Location	12q14
Pathway	ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function	cytokine activity; interferon-gamma receptor binding;