Recombinant Human IFNA2 therapeutic protein(Interferon alfa-2b)

• Cat.No.: IFNA2-P008H
• Product Overview: Recombint Human Interferon, Alpha 2 therapeutic protein(human leukocyte clone hif-sn 206 protein moiety reduced). A type I interferon consisting of 165 amino acid residues with arginine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent.

Specification

• Description: This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. The expression product is the active ingredient of PEG-Intron, Unitron PEG, Roferon-A and Intron-A.
• Source: E. coli
• Species: Human
• Molecular Mass: 31 Kda
• Protein length: 165aa
• AA Sequence: CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKD SSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEV VRAEIMRSFSLSTNLQESLRSKE
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Tag: Non
• Alias: IFNA2; IFN alphaA; IFNA; INFA2; IFNA2B; IFN-alphaA; Interferon alfa-2b; Interferon alfa-2b (recombinant); Interferon alfa-2b, recombinant; Interferon alpha-2B; Interferon α-2b; Intron (Interferon α2b); Intron A; Intron A (Interferon α2b); r-INF-alpha; rIFN-alpha-2b

Gene Information

• Gene Name: IFNA2 interferon, alpha 2 [ Homo sapiens ]
• Official Symbol: IFNA2
• Synonyms: IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765
• Gene ID: 3440
• mRNA Refseq: NM_000605
• Protein Refseq: NP_000596
• MIM: 147562
• UniProt ID: P01563
• Chromosome Location: 9p22
• Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem
• Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding