Recombinant Human INS Protein, His-tagged

• Cat.No.: INS-856H
• Product Overview: Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli.

Specification

• Description: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Tag: His
• Form: PBS, pH 7.4
• AA sequence: HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS

Gene Information

• Gene Name: INS insulin [ Homo sapiens ]
• Official Symbol: INS
• Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10
• Gene ID: 3630
• mRNA Refseq: NM_000207
• Protein Refseq: NP_000198
• UniProt ID: P01308