Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged

• Cat.No.: INS-623C
• Product Overview: Recombinant Full Length Cynomolgus Monkey insulin Protein (25-110 aa) with His tag was expressed in HEK293.

Specification

• Description: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
• Source: HEK293
• Species: Cynomolgus Monkey
• Tag: C-His
• Protein length: 25-110 aa
• Molecular Mass: 10.5 kDa
• AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDPQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 85 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: PBS, pH 7.4
• Concentration: 0.15 mg/mL

Gene Information

• Gene Name: INS insulin [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: INS
• Synonyms: INS; insulin; preproinsulin
• Gene ID: 704534
• mRNA Refseq: XM_028833049
• Protein Refseq: XP_028688882
• UniProt ID: F7AUL3